PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0050s0134.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MIKC_MADS
Protein Properties Length: 214aa    MW: 24445.9 Da    PI: 9.4279
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0050s0134.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF95.72.1e-30959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         krien + rqvtfskRrng+lKKA+ELSvLCdaev++iifs++gklye++s
  Cagra.0050s0134.1.p  9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKGKLYEFAS 59
                         79***********************************************86 PP

2K-box96.25e-3277171498
                K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenka 93 
                           s+k ++e+++++l+ e+a++ k+ie+L+ ++R+llGe+++s+s++eLqq+eqqLeks+k iR++K+++++eqie+l++kek+l  en++
  Cagra.0050s0134.1.p  77 VSTKPVSEENMQHLKYEAANMMKKIEQLEASKRKLLGEGIGSCSIEELQQIEQQLEKSVKCIRARKTQVFKEQIEQLKQKEKALAAENEK 166
                          466679************************************************************************************ PP

                K-box  94 Lrkkl 98 
                          L++k+
  Cagra.0050s0134.1.p 167 LTEKW 171
                          **997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.8E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.735161IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-33383IPR002100Transcription factor, MADS-box
CDDcd002657.84E-42378No hitNo description
PRINTSPR004047.9E-31323IPR002100Transcription factor, MADS-box
PfamPF003192.0E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004047.9E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004047.9E-313859IPR002100Transcription factor, MADS-box
PfamPF014863.9E-2984170IPR002487Transcription factor, K-box
PROSITE profilePS5129715.79787177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000060Biological Processprotein import into nucleus, translocation
GO:0009409Biological Processresponse to cold
GO:0009739Biological Processresponse to gibberellin
GO:0009911Biological Processpositive regulation of flower development
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MVRGKTQMKR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVSLIIFSP KGKLYEFASS  60
NMQDTIERYL RHTKDRVSTK PVSEENMQHL KYEAANMMKK IEQLEASKRK LLGEGIGSCS  120
IEELQQIEQQ LEKSVKCIRA RKTQVFKEQI EQLKQKEKAL AAENEKLTEK WGSHESEVWS  180
NKNQESGRGD EESSPSSEVE TQLFIGLPCS SRK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D3e-19369268Myocyte-specific enhancer factor 2A
3mu6_C3e-19369268Myocyte-specific enhancer factor 2A
3mu6_B3e-19369268Myocyte-specific enhancer factor 2A
3mu6_A3e-19369268Myocyte-specific enhancer factor 2A
1egw_D4e-19369268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C4e-19369268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B4e-19369268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A4e-19369268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J4e-19369268Myocyte-specific enhancer factor 2A
3p57_I4e-19369268Myocyte-specific enhancer factor 2A
3p57_D4e-19369268Myocyte-specific enhancer factor 2A
3p57_C4e-19369268Myocyte-specific enhancer factor 2A
3p57_B4e-19369268Myocyte-specific enhancer factor 2A
3p57_A4e-19369268Myocyte-specific enhancer factor 2A
3kov_J4e-19369268Myocyte-specific enhancer factor 2A
3kov_I4e-19369268Myocyte-specific enhancer factor 2A
3kov_B4e-19369268Myocyte-specific enhancer factor 2A
3kov_A4e-19369268Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00076ChIP-chipTransfer from AT2G45660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3857310.0AF385731.1 Arabidopsis thaliana At2g45660/F17K2.19 mRNA, complete cds.
GenBankAY0077260.0AY007726.1 Arabidopsis thaliana MADS box protein AGL20 mRNA, complete cds.
GenBankAY0939670.0AY093967.1 Arabidopsis thaliana At2g45660/F17K2.19 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006294978.11e-154hypothetical protein CARUB_v10024046mg
SwissprotO646451e-145SOC1_ARATH; MADS-box protein SOC1
TrEMBLR0FYN51e-154R0FYN5_9BRAS; Uncharacterized protein
STRINGBra000393.1-P1e-148(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.11e-126AGAMOUS-like 20